PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00116954001
Common NameGSBRNA2T00116954001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 326aa    MW: 34737 Da    PI: 9.067
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00116954001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.56.8e-3977136362
               zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          e+alkcprC+stntkfCy+nnysl+qPr+fCk+CrryWt+GGalrnvPvGgg+r+n++++
  GSBRNA2T00116954001  77 EAALKCPRCESTNTKFCYFNNYSLTQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNRRTK 136
                          7789*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3664134IPR003851Zinc finger, Dof-type
PfamPF027013.9E-3279134IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.47880134IPR003851Zinc finger, Dof-type
PROSITE patternPS01361082118IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MVFSSIQAYL DSSNWQQAPP SNYNQGGAGA SATGGHGLPP QLQPQSQPLS NGSGGSGSIR  60
PGSMVDRARQ ANVAMPEAAL KCPRCESTNT KFCYFNNYSL TQPRHFCKTC RRYWTRGGAL  120
RNVPVGGGCR RNRRTKSSSN NNSSTATSNN TSFSSAASGN ASTISAILSS NYGGTHENIL  180
SQILSPGRLM NPGYNHHLGD LTDNTKTDNN MSLLNYGGLS QDLRSIHMGN SGGSLMSCVD  240
EWRTASHHQQ PQILGGGNLE DSNPNPSSNG FYPFESPRIT SASISSALAS QFSSVKVEDN  300
NPYKWVNVNG NCSSWTDLST FGSSR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1120133RNVPVGGGCRRNRR
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00116954001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0046840.0AC004684.3 Arabidopsis thaliana chromosome 2 clone F13M22 map ve018, complete sequence.
GenBankBT0300140.0BT030014.1 Arabidopsis thaliana At2g37590 mRNA, complete cds.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013634102.10.0PREDICTED: dof zinc finger protein DOF2.4 isoform X1
SwissprotO809281e-168DOF24_ARATH; Dof zinc finger protein DOF2.4
TrEMBLA0A078CDM10.0A0A078CDM1_BRANA; BnaA05g06930D protein
STRINGBra005181.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM113541732
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.11e-146DNA binding with one finger 2.4
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]